Structure of PDB 5n10 Chain B Binding Site BS01

Receptor Information

>5n10 Chain B (length=236) Species: 9606 (Homo sapiens)

QGSMTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLS
VAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICN
DVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNS
QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTA
FDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSE

Ligand information

>5n10 Chain F (length=5) Species: 9606 (Homo sapiens)

FPATV

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5n10 A Binary Bivalent Supramolecular Assembly Platform Based on Cucurbit[8]uril and Dimeric Adapter Protein 14-3-3.
• Resolution: 1.6 Å
• Binding residue (original residue number in PDB): K51 R58 R62 R129 Y130 L174 N175 V178 N226
• Binding residue (residue number reindexed from 1): K54 R61 R65 R132 Y133 L177 N178 V181 N229

Gene Ontology

Molecular Function

• GO:0004860 protein kinase inhibitor activity
• GO:0005515 protein binding
• GO:0019899 enzyme binding
• GO:0019904 protein domain specific binding
• GO:0042802 identical protein binding
• GO:0042826 histone deacetylase binding
• GO:0045296 cadherin binding
• GO:0050815 phosphoserine residue binding
• GO:0051219 phosphoprotein binding

Biological Process

• GO:0006605 protein targeting
• GO:0007165 signal transduction
• GO:0008104 protein localization
• GO:0043085 positive regulation of catalytic activity
• GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
• GO:0051220 cytoplasmic sequestering of protein

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005773 vacuole
• GO:0005774 vacuolar membrane
• GO:0005829 cytosol
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0042470 melanosome
• GO:0048471 perinuclear region of cytoplasm
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:5n10, PDBe:5n10, PDBj:5n10
• PDBsum: 5n10
• PubMed: 28510303
• UniProt: P31946|1433B_HUMAN 14-3-3 protein beta/alpha (Gene Name=YWHAB)