Structure of PDB 5myo Chain B Binding Site BS01

Receptor Information
>5myo Chain B (length=221) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGPELVKPGASMKISCKASGYSFTGYTMNWVKQSHGKNLEWIGL
INPYNGVTRYNQKFKGKATLIVDKSSSTAYMELLSLTSEDSAVYYCTREA
KREWDETYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKG
YFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVT
CNVAHPASSTKVDKKIVPRDC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5myo Structural and functional analyses of pyroglutamate-amyloid-beta-specific antibodies as a basis for Alzheimer immunotherapy.
Resolution1.59 Å
Binding residue
(original residue number in PDB)		T33 N35 L50 N52 T97 R98 E99 A100 K101 T107
Binding residue
(residue number reindexed from 1)		T33 N35 L50 N52 T97 R98 E99 A100 K101 T107
External links