Structure of PDB 5myk Chain B Binding Site BS01

Receptor Information
>5myk Chain B (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLVESGGGLVQPGGSRKLSCAASGFTFSDYGMAWVRQAPGKGPEWVAF
ISNLAYSIYYADTVTGRFTISRENAKNTLYLEMSSLRSEDTAMYYCARYD
YDNILDYVMDYWGQGTSVTVSSAKTTPPSVYPLAPGCGSSVTLGCLVKGY
FPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTC
SVAHPASSTTVDKKLEPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5myk Structural and functional analyses of pyroglutamate-amyloid-beta-specific antibodies as a basis for Alzheimer immunotherapy.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		D31 F50 S52 N53 L54 Y56 Y59 Y99 Y101 I104 L105 D106
Binding residue
(residue number reindexed from 1)		D31 F50 S52 N53 L54 Y56 Y59 Y99 Y101 I104 L105 D106
External links