Structure of PDB 5mpf Chain B Binding Site BS01

Receptor Information

>5mpf Chain B (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NNFEYTLEASKSLRQKSTMTYLNKGQFYPITLKEVSSKVRSVIMVVFAED
KSREDQLRHWKYWHSRQHTAKQRCIDIADYKESFNTISNVEEIAYNAISF
TWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQIDTYSYNNRSNKPVH
RAYCQIKVFCDKGAERKIRDEERKQSKRKMDITVFKPFIDLDTQPVLFIP
DV

Ligand information

>5mpf Chain E (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaccggtttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mpf Structural basis of gene regulation by the Grainyhead/CP2 transcription factor family.
Resolution	2.918 Å
Binding residue (original residue number in PDB)	Q385 K386 G387 V388 R430
Binding residue (residue number reindexed from 1)	Q124 K125 G126 V127 R169
Binding affinity	PDBbind-CN: Kd=90nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5mpf, PDBe:5mpf, PDBj:5mpf
PDBsum	5mpf
PubMed	29309642
UniProt	Q9NZI5\|GRHL1_HUMAN Grainyhead-like protein 1 homolog (Gene Name=GRHL1)

[Back to BioLiP]