Structure of PDB 5miz Chain B Binding Site BS01

Receptor Information

>5miz Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>5miz Chain A (length=21) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCASVCSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5miz MD ensemble of bovine insulin
Resolution	N/A
Binding residue (original residue number in PDB)	C7 G8 S9 C19
Binding residue (residue number reindexed from 1)	C7 G8 S9 C19

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5miz, PDBe:5miz, PDBj:5miz
PDBsum	5miz
PubMed
UniProt	P01317\|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]