Structure of PDB 5mhd Chain B Binding Site BS01

Receptor Information
>5mhd Chain B (length=31) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVKQHLCGSHLVEALYLVCGERGFFYTPKTR
Ligand information
>5mhd Chain A (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCNS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mhd Structure and pharmaceutical formulation development of a new long-acting recombinant human insulin analog studied by NMR and MS.
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25
Binding residue
(residue number reindexed from 1)		F1 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5mhd, PDBe:5mhd, PDBj:5mhd
PDBsum5mhd
PubMed28024260
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]