Structure of PDB 5mfj Chain B Binding Site BS01

Receptor Information
>5mfj Chain B (length=240) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQKLIEAGALSPLVK
LLDDASEEVIQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEE
VIQEAVWAIANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWA
IANIASGNNEQIQKLIEAGALSPLVKLLDDASEEVIQEAVWAIANIASGN
NEQIQKLEEAGAEPALEKLQSSPNEEVQKNAQAALEALNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mfj Curvature of designed armadillo repeat proteins allows modular peptide binding.
Resolution1.53 Å
Binding residue
(original residue number in PDB)		N126 N127 S166 G167 N168 N169 I172 W201 N205 S208 E236 A243
Binding residue
(residue number reindexed from 1)		N116 N117 S156 G157 N158 N159 I162 W191 N195 S198 E226 A233
External links