Structure of PDB 5mcw Chain B Binding Site BS01

Receptor Information

>5mcw Chain B (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPV
QLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQH
LIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCM
GGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK

Ligand information

>5mcw Chain C (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggcgcgcccgggcgcgccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mcw New Insights into the Role of DNA Shape on Its Recognition by p53 Proteins.
Resolution	1.897 Å
Binding residue (original residue number in PDB)	S241 R273 C275 A276 R280
Binding residue (residue number reindexed from 1)	S148 R180 C182 A183 R187

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5mcw, PDBe:5mcw, PDBj:5mcw
PDBsum	5mcw
PubMed	30057026
UniProt	P04637\|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]