Structure of PDB 5m0i Chain B Binding Site BS01

Receptor Information
>5m0i Chain B (length=238) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LGSDIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFER
TTLIKFVKKLRFYNDSVLSYNASEFINEGKNELDPEADSFDKVILPIASM
FVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFV
KFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGTDNIFLQEILPVNSEEE
FQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGKLK
Ligand information
>5m0i Chain E (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gauaacugaaucgaaagacauuaucacg
<<<<......<<....>>...>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5m0i Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
Resolution2.41 Å
Binding residue
(original residue number in PDB)
N36 K37 S40 H41 R43 R49 R52 I56 K60 R63 H238 G242 K243
Binding residue
(residue number reindexed from 1)
N34 K35 S38 H39 R41 R47 R50 I54 K58 R61 H231 G235 K236
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0007533 mating type switching
GO:0008298 intracellular mRNA localization
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005934 cellular bud tip

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5m0i, PDBe:5m0i, PDBj:5m0i
PDBsum5m0i
PubMed28092367
UniProtP36068|SHE2_YEAST SWI5-dependent HO expression protein 2 (Gene Name=SHE2)

[Back to BioLiP]