Structure of PDB 5lyn Chain B Binding Site BS01

Receptor Information
>5lyn Chain B (length=133) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANR
AAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEA
YKKVLDIEGDNATEAMKRDYESAKKKVEQSLNL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lyn Structure and Interactions of the TPR Domain of Sgt2 with Yeast Chaperones and Ybr137wp.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
N110 M113 Y125 N141 Y169 R171 R175 F178 D211
Binding residue
(residue number reindexed from 1)
N18 M21 Y33 N49 Y77 R79 R83 F86 D119
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5lyn, PDBe:5lyn, PDBj:5lyn
PDBsum5lyn
PubMed29075633
UniProtQ12118|SGT2_YEAST Small glutamine-rich tetratricopeptide repeat-containing protein 2 (Gene Name=SGT2)

[Back to BioLiP]