Structure of PDB 5lum Chain B Binding Site BS01

Receptor Information
>5lum Chain B (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRY
RLPPGVDPAAVTSALSPEGVLSIQAAPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lum Structural Basis for the Interaction of a Human Small Heat Shock Protein with the 14-3-3 Universal Signaling Regulator.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		T133 A135 S137 E139 V141 S143 Q145
Binding residue
(residue number reindexed from 1)		T62 A64 S66 E68 V70 S72 Q74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5lum, PDBe:5lum, PDBj:5lum
PDBsum5lum
PubMed28089448
UniProtO14558|HSPB6_HUMAN Heat shock protein beta-6 (Gene Name=HSPB6)

[Back to BioLiP]