Structure of PDB 5lm7 Chain B Binding Site BS01

Receptor Information

>5lm7 Chain B (length=134) Species: 585035 (Escherichia coli S88)

AARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLA
GVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVA
INEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPN

Ligand information

>5lm7 Chain R (length=29)

cucuuuaacauuaagcccugaagaagggc

..............<<<<<.....>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5lm7 Structural basis for lambda N-dependent processive transcription antitermination.
• Resolution: 3.35 Å
• Binding residue (original residue number in PDB): Y69 L77 G78 E81 K101 V102 I104 N105 I108 E109 E117 S119 K121 F122 V123 N124 G125 V126 L127
• Binding residue (residue number reindexed from 1): Y66 L74 G75 E78 K98 V99 I101 N102 I105 E106 E114 S116 K118 F119 V120 N121 G122 V123 L124

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0006353 DNA-templated transcription termination
• GO:0006355 regulation of DNA-templated transcription
• GO:0031564 transcription antitermination
• GO:0032784 regulation of DNA-templated transcription elongation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005829 cytosol
• GO:0008023 transcription elongation factor complex

External links

• PDB: RCSB:5lm7, PDBe:5lm7, PDBj:5lm7
• PDBsum: 5lm7
• PubMed: 28452979
• UniProt: P0A780|NUSB_ECOLI Transcription antitermination protein NusB (Gene Name=nusB)