Structure of PDB 5lcl Chain B Binding Site BS01

Receptor Information
>5lcl Chain B (length=114) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APKCIECHINIEMDPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYF
LTDPELNDEDLFHRLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGL
DEEWQRREEGKAHR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lcl Structural Insights into the Recognition of N(2) -Aryl- and C8-Aryl DNA Lesions by the Repair Protein XPA/Rad14.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		T228 K229 T230 E231 E234 N256 H258 A263 R264 M265 Q266
Binding residue
(residue number reindexed from 1)		T41 K42 T43 E44 E47 N69 H71 A76 R77 M78 Q79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000715 nucleotide-excision repair, DNA damage recognition
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006289 nucleotide-excision repair
GO:0006974 DNA damage response
GO:0070914 UV-damage excision repair
GO:1901255 nucleotide-excision repair involved in interstrand cross-link repair
Cellular Component
GO:0000110 nucleotide-excision repair factor 1 complex
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lcl, PDBe:5lcl, PDBj:5lcl
PDBsum5lcl
PubMed28444956
UniProtP28519|RAD14_YEAST DNA repair protein RAD14 (Gene Name=RAD14)

[Back to BioLiP]