Structure of PDB 5l20 Chain B Binding Site BS01

Receptor Information
>5l20 Chain B (length=223) Species: 226186 (Bacteroides thetaiotaomicron VPI-5482) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YFGGLNAQYQTDITTLAKGISNAGLKMEYILFDDCYMSSIEVAYALKDVT
DYLIGSTSEVMAYGMPYAEIGQYLIGKVDYAGICDGFYSFYSTYSTPCGT
IAVTDCSELDNLATIMKEINHRYTFDPSLTSSLQRLDGYYPVIFFDYGDY
VSKLCPDETLVARFNEQLNRTVPFKRNTEYFYSMSRGEVKINTFSGITIS
DPSTHSLASKKEETAWYAATHLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l20 Crystal Structure of a Clostripain (BT_0727) from Bacteroides thetaiotaomicron ATCC 29148 in Complex with Peptide Inhibitor BTN-VLTK-AOMK
Resolution1.45 Å
Binding residue
(original residue number in PDB)
E231 V232 M233 A234 M356
Binding residue
(residue number reindexed from 1)
E59 V60 M61 A62 M184
Enzymatic activity
Enzyme Commision number ?
External links