Structure of PDB 5l0y Chain B Binding Site BS01

Receptor Information
>5l0y Chain B (length=149) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNPKRSANINKLRESGNAEYRKQRYGDAIKLYTLGLQMALTRPAWEPAGL
VRDEIHQLYSNRAQAYMQLGQWPEAAADAECSVEAKRQGNAKAWYRRGKC
LMEMRRLQEAREWVARGLEFEGEEKELAELLKEIDSKLAAEKASRDAHD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5l0y Two alternative binding mechanisms connect the protein translocation Sec71-Sec72 complex with heat shock proteins.
Resolution2.87 Å
Binding residue
(original residue number in PDB)
N84 Y87 Q124 N128 Q131 K159
Binding residue
(residue number reindexed from 1)
N17 Y20 Q57 N61 Q64 K92
Enzymatic activity
Enzyme Commision number ?
External links