Structure of PDB 5ksv Chain B Binding Site BS01

Receptor Information
>5ksv Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVM
LEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ksv Unraveling the structural basis for the unusually rich association of human leukocyte antigen DQ2.5 with class-II-associated invariant chain peptides.
Resolution2.195 Å
Binding residue
(original residue number in PDB)		G13 L26 W61 I67 R70 R77 H81 N82 L85 R88
Binding residue
(residue number reindexed from 1)		G11 L24 W59 I65 R68 R75 H79 N80 L83 R86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ksv, PDBe:5ksv, PDBj:5ksv
PDBsum5ksv
PubMed28364043
UniProtQ5Y7D3

[Back to BioLiP]