Structure of PDB 5ks9 Chain B Binding Site BS01

Receptor Information
>5ks9 Chain B (length=181) Species: 4565,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVT
PLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTI
SPLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVML
EMTPQRGDVYTCHVEHPSLQNPIIVEWRAQS
Ligand information
>5ks9 Chain J (length=16) Species: 4565 (Triticum aestivum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APSGEGSFQPSQENPQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ks9 Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		F11 G13 C15 Y30 Y37 Y47 A57 Y60 W61 R70 E74 V78 H81 N82 L85
Binding residue
(residue number reindexed from 1)		F10 G12 C14 Y29 Y36 Y46 A56 Y59 W60 R69 E73 V77 H80 N81 L84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ks9, PDBe:5ks9, PDBj:5ks9
PDBsum5ks9
PubMed27568928
UniProtA0A0U5Q247;
R9XSW3

[Back to BioLiP]