Structure of PDB 5krb Chain B Binding Site BS01

Receptor Information

>5krb Chain B (length=74) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QRTCLICGDRATGLHYGIISCEGCKGFFKRSISNKRVYRCSRDKNCVMSR
KQRNRCQYCRLLKCLQMGMNRKAI

Ligand information

>5krb Chain A (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agaggtcaaggctaga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5krb A Structural Investigation into Oct4 Regulation by Orphan Nuclear Receptors, Germ Cell Nuclear Factor (GCNF), and Liver Receptor Homolog-1 (LRH-1).
Resolution	2.101 Å
Binding residue (original residue number in PDB)	L85 H86 Y87 K96 K100
Binding residue (residue number reindexed from 1)	L14 H15 Y16 K25 K29
Binding affinity	PDBbind-CN: Kd=170nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5krb, PDBe:5krb, PDBj:5krb
PDBsum	5krb
PubMed	27984042
UniProt	Q64249\|NR6A1_MOUSE Nuclear receptor subfamily 6 group A member 1 (Gene Name=Nr6a1)

[Back to BioLiP]