Structure of PDB 5koa Chain B Binding Site BS01

Receptor Information
>5koa Chain B (length=246) Species: 585035 (Escherichia coli S88) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFRNVSELL
DVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSV
LISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRD
SQVETWIASLNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLL
RLNLSLDSQLYPQISGHKSRFAIRFMPLDSENGQVPERLDFELACC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5koa Structure of Escherichia coli ZapD bound to the C-terminal tail of FtsZ
Resolution2.67 Å
Binding residue
(original residue number in PDB)		W77 G82 V83 D84 Q177
Binding residue
(residue number reindexed from 1)		W76 G81 V82 D83 Q176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000917 division septum assembly
GO:0043093 FtsZ-dependent cytokinesis
GO:0051301 cell division
GO:0090529 cell septum assembly
Cellular Component
GO:0005737 cytoplasm
GO:0032153 cell division site

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5koa, PDBe:5koa, PDBj:5koa
PDBsum5koa
PubMed
UniProtB7MAM4|ZAPD_ECO45 Cell division protein ZapD (Gene Name=zapD)

[Back to BioLiP]