Structure of PDB 5kl1 Chain B Binding Site BS01

Receptor Information
>5kl1 Chain B (length=70) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAH
TIKYCPKKPIITMEDAIKAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kl1 Drosophila Nanos acts as a molecular clamp that modulates the RNA-binding and repression activities of Pumilio.
Resolution3.701 Å
Binding residue
(original residue number in PDB)		V320 F321 N324 N325 L349 Y352 H365 T366 I367 K368 Y369
Binding residue
(residue number reindexed from 1)		V5 F6 N9 N10 L34 Y37 H50 T51 I52 K53 Y54
Binding affinityPDBbind-CN: Kd=8.7nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5kl1, PDBe:5kl1, PDBj:5kl1
PDBsum5kl1
PubMed27482653
UniProtP25724|NANOS_DROME Protein nanos (Gene Name=nanos)

[Back to BioLiP]