Structure of PDB 5k7z Chain B Binding Site BS01

Receptor Information

>5k7z Chain B (length=184) Species: 246197 (Myxococcus xanthus DK 1622) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RYRAILETAARLICDRGYEGTSMQEIAAACRMTKAGLYHHIQNKEQLLFA
IMNYGMDLFEEQVLSRVQDIANPVERLRACMRHNILLVTRGWSKEVIIIL
HEHATLTGETRAFIDARKKKYVDFLEEAFSQASQQGLIRPVDPTVGAFSF
LGMVLWIYKWFKPDGRLTDEQIADGMVGMLFPPF

Ligand information

>5k7z Chain E (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cctaccgatcggtagg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5k7z Crystal structure of AibR in complex with isovaleryl coenzyme A and operator DNA
Resolution	2.92 Å
Binding residue (original residue number in PDB)	M45 T46 A48 H53
Binding residue (residue number reindexed from 1)	M32 T33 A35 H40

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5k7z, PDBe:5k7z, PDBj:5k7z
PDBsum	5k7z
PubMed
UniProt	Q1D4I5

[Back to BioLiP]