Structure of PDB 5k5g Chain B Binding Site BS01

Receptor Information
>5k5g Chain B (length=44) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGEIVYLPNLNPDQLCAFIHSIHDDPSQSANLLAEAKKLNDAQA
Ligand information
>5k5g Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QRLANFLVHSSNNFGAILSST
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5k5g beta-Hairpin of Islet Amyloid Polypeptide Bound to an Aggregation Inhibitor.
ResolutionN/A
Binding residue
(original residue number in PDB)
G14 E15 I16 V17 Y18 L19 P20 L27 I31 L45
Binding residue
(residue number reindexed from 1)
G2 E3 I4 V5 Y6 L7 P8 L15 I19 L33
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Nov 25 05:48:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5k5g', asym_id = 'B', bs = 'BS01', title = 'beta-Hairpin of Islet Amyloid Polypeptide Bound to an Aggregation Inhibitor.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5k5g', asym_id='B', bs='BS01', title='beta-Hairpin of Islet Amyloid Polypeptide Bound to an Aggregation Inhibitor.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0019865', uniprot = '', pdbid = '5k5g', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0019865', uniprot='', pdbid='5k5g', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>