Structure of PDB 5jjv Chain B Binding Site BS01

Receptor Information
>5jjv Chain B (length=356) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKHPLEELKDPTENLLLWIGRFLRYKCTSLSNSQVKDQNKVFECLNELN
QACSSSQLEKVCKKARNAGLLGINTYALPLLKFHEYFSKARLITERLAFN
SLKNIDEVMLAEFLSVYTGGLSLATKKNYRIALLGLFSYIDKQNQDENEK
SYIYNITLKNISGNKLPTHLNNEELEKFLESIDKIEMSAKVRARNRLLIK
IIVFTGMRSNEALQLKIKDFTLENGCYTILIKGKGDKYRAVMLKAFHIES
LLKEWLIERELYPVKNDLLFCNQKGSALTQAYLYKQVERIINFAGLRREK
NGAHMLRHSFATLLYQKRHDLILVQEALGHASLNTSRIYTHFDKQRLEEA
ASIWEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5jjv Structural snapshots of Xer recombination reveal activation by synaptic complex remodeling and DNA bending.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
K62 R65 N66 L77 L120 S121 A123 T124 N127 S193 R199 R213 K239 N277 Q278 T284 A286 Y287 K290 K305 H309 R312 H313 H335 Y344
Binding residue
(residue number reindexed from 1)
K63 R66 N67 L78 L121 S122 A124 T125 N128 S188 R194 R208 K234 N272 Q273 T279 A281 Y282 K285 K300 H304 R307 H308 H330 Y339
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0009037 tyrosine-based site-specific recombinase activity
Biological Process
GO:0006310 DNA recombination
GO:0007059 chromosome segregation
GO:0015074 DNA integration
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5jjv, PDBe:5jjv, PDBj:5jjv
PDBsum5jjv
PubMed28009253
UniProtO25386|XERH_HELPY Tyrosine recombinase XerH (Gene Name=xerH)

[Back to BioLiP]