Structure of PDB 5j3e Chain B Binding Site BS01

Receptor Information

>5j3e Chain B (length=171) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLR
AMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKE
DNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRL
SIQPLTQEEFDFVLSLEEKEP

Ligand information

>5j3e Chain C (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccaacgttggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5j3e Crystal Structure of Human THYN1 protein in complex with 5-methylcytosine containing DNA
Resolution	2.6 Å
Binding residue (original residue number in PDB)	N95 Y96 S150 K157 R200 R202
Binding residue (residue number reindexed from 1)	N42 Y43 S97 K104 R147 R149

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5j3e, PDBe:5j3e, PDBj:5j3e
PDBsum	5j3e
PubMed
UniProt	Q9P016\|THYN1_HUMAN Thymocyte nuclear protein 1 (Gene Name=THYN1)

[Back to BioLiP]