Structure of PDB 5itf Chain B Binding Site BS01

Receptor Information

>5itf Chain B (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGV
IWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALT
YYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKRVEPK

Ligand information

>5itf Chain E (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GQFDLSTRRLKG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5itf Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
Resolution	2.51 Å
Binding residue (original residue number in PDB)	Q39 P41 I92 Y94 Q111
Binding residue (residue number reindexed from 1)	Q39 P41 I92 Y94 Q111

External links

PDB	RCSB:5itf, PDBe:5itf, PDBj:5itf
PDBsum	5itf
PubMed	27834791

[Back to BioLiP]