Structure of PDB 5icv Chain B Binding Site BS01

Receptor Information

>5icv Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFS
LAATYRGAIVGMIVAEIKNRTKIHKEDGDILASNFSVDTQVAYILSLGVV
KEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFYENRD
FKQHHYLPYYYSIRGVLKDGFTYVLYINGG

Ligand information

>5icv Chain D (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MKAV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5icv Crystal Structure of the Golgi-Associated Human N alpha-Acetyltransferase 60 Reveals the Molecular Determinants for Substrate-Specific Acetylation.
Resolution	1.53 Å
Binding residue (original residue number in PDB)	I36 Y38 L99 Y165
Binding residue (residue number reindexed from 1)	I32 Y34 L95 Y161

Enzymatic activity

Enzyme Commision number

2.3.1.259: N-terminal methionine N(alpha)-acetyltransferase NatF.
2.3.1.48: histone acetyltransferase.

Gene Ontology

	Molecular Function
GO:0004596	peptide alpha-N-acetyltransferase activity
GO:0016747	acyltransferase activity, transferring groups other than amino-acyl groups

View graph for
Molecular Function

External links

PDB	RCSB:5icv, PDBe:5icv, PDBj:5icv
PDBsum	5icv
PubMed	27320834
UniProt	Q9H7X0\|NAA60_HUMAN N-alpha-acetyltransferase 60 (Gene Name=NAA60)

[Back to BioLiP]