Structure of PDB 5ic3 Chain B Binding Site BS01

Receptor Information
>5ic3 Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVG
DAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ic3 CAL PDZ domain with peptide and inhibitor
Resolution1.7 Å
Binding residue
(original residue number in PDB)		G290 L291 G292 I293 S294 I295 T296 S308 E309 H341
Binding residue
(residue number reindexed from 1)		G15 L16 G17 I18 S19 I20 T21 S33 E34 H66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005794 Golgi apparatus

View graph for
Cellular Component
External links
PDB RCSB:5ic3, PDBe:5ic3, PDBj:5ic3
PDBsum5ic3
PubMed
UniProtQ9HD26|GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein (Gene Name=GOPC)

[Back to BioLiP]