Structure of PDB 5hyt Chain B Binding Site BS01

Receptor Information
>5hyt Chain B (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNS
DGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIG
STTSRCEVQDRGVGWSHPLPQCEI
Ligand information
>5hyt Chain A (length=29) Species: 1314 (Streptococcus pyogenes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ISQESKLINTLTDENEKLREELQQYYALS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hyt Conserved patterns hidden within group A Streptococcus M protein hypervariability recognize human C4b-binding protein.
Resolution2.54 Å
Binding residue
(original residue number in PDB)
R39 S40 H41 S42 I61 R66 H67
Binding residue
(residue number reindexed from 1)
R39 S40 H41 S42 I61 R66 H67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5hyt, PDBe:5hyt, PDBj:5hyt
PDBsum5hyt
PubMed27595425
UniProtP04003|C4BPA_HUMAN C4b-binding protein alpha chain (Gene Name=C4BPA)

[Back to BioLiP]