Structure of PDB 5ht2 Chain B Binding Site BS01

Receptor Information
>5ht2 Chain B (length=249) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STISFITWNIDGLDGCNLPERARGVCSCLALYSPDVVFLQEVIPPYCAYL
KKRAASYTIITGNEEGYFTAILLKKGRVKFKSQEIIPFPNTKMMRNLLCV
NVSLGGNEFCLMTSHLESTREHSAERIRQLKTVLGKMQEAPDSTTVIFAG
DTNLRDQEVIKCGGLPDNVFDAWEFLGKPKHCQYTWDTKANNNLRIPAAY
KHRFDRIFFRAEEGHLIPQSLDLVGLEKLDCGRFPSDHWGLLCTLNVVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ht2 Reversal of DNA damage induced Topoisomerase 2 DNA-protein crosslinks by Tdp2.
Resolution1.43 Å
Binding residue
(original residue number in PDB)		H236 S239 T240 R241 D272 N274 R276 W307 L315 I317 Y321 F325 H359
Binding residue
(residue number reindexed from 1)		H115 S118 T119 R120 D151 N153 R155 W186 L194 I196 Y200 F204 H238
Enzymatic activity
Enzyme Commision number 3.1.4.-
Gene Ontology
Molecular Function
GO:0003824 catalytic activity

View graph for
Molecular Function
External links
PDB RCSB:5ht2, PDBe:5ht2, PDBj:5ht2
PDBsum5ht2
PubMed27060144
UniProtQ9JJX7|TYDP2_MOUSE Tyrosyl-DNA phosphodiesterase 2 (Gene Name=Tdp2)

[Back to BioLiP]