Structure of PDB 5hoo Chain B Binding Site BS01

Receptor Information
>5hoo Chain B (length=336) Species: 7226 (Drosophila mauritiana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQR
FKSGDFDVDDKEHGKPPKRYEDAELQALLDEDDAQTQKQLAEQLEVSQQA
VSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRI
VTGDEKWIFFVNPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGV
IYYELLKPGETVNAARYQQQLINLNRALQRKRPRVIFLHDNAPSHTARAV
RDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKW
LDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hoo A bend, flip and trap mechanism for transposon integration.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
Y171 S290 H293 F321
Binding residue
(residue number reindexed from 1)
Y169 S281 H284 F312
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0004519 endonuclease activity
GO:0042800 histone H3K4 methyltransferase activity
GO:0044547 DNA topoisomerase binding
GO:0046872 metal ion binding
GO:0046975 histone H3K36 methyltransferase activity
Biological Process
GO:0000729 DNA double-strand break processing
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006310 DNA recombination
GO:0006338 chromatin remodeling
GO:0015074 DNA integration
GO:0031297 replication fork processing
GO:0044774 mitotic DNA integrity checkpoint signaling
Cellular Component
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0035861 site of double-strand break

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5hoo, PDBe:5hoo, PDBj:5hoo
PDBsum5hoo
PubMed27223327
UniProtQ7JQ07|MOS1T_DROMA Mariner Mos1 transposase (Gene Name=mariner\T)

[Back to BioLiP]