Structure of PDB 5hjs Chain B Binding Site BS01

Receptor Information
>5hjs Chain B (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLSPEQLGMIEKLVAAQQLRVTPWPSREARQQRFAHFTELAIVSVQEIVD
FAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFS
YNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRP
NVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hjs Identification and in Vivo Evaluation of Liver X Receptor beta-Selective Agonists for the Potential Treatment of Alzheimer's Disease.
Resolution1.72 Å
Binding residue
(original residue number in PDB)		V105 K109 E120 I123 A124 K127 N207 P273 L274 E277
Binding residue
(residue number reindexed from 1)		V49 K53 E64 I67 A68 K71 N151 P217 L218 E221
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006629 lipid metabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5hjs, PDBe:5hjs, PDBj:5hjs
PDBsum5hjs
PubMed27011007
UniProtQ13133|NR1H3_HUMAN Oxysterols receptor LXR-alpha (Gene Name=NR1H3)

[Back to BioLiP]