Structure of PDB 5hab Chain B Binding Site BS01

Receptor Information
>5hab Chain B (length=463) Species: 1094980 (Methanolobus psychrophilus R15) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHSSGLVPRGSHMASTEIGIIAVGGYNEMGRNMTAIRVNEDIIIIDMGI
RLDRVQIHEDVDTDRMHSLELIEMGAIPDDTIMNEVNGNVRAIVCTHGAL
DHIGAIPKLAHRYAAPIIATPYTTALIKHQIDSERKFGVKNNIVALKAGE
TLEITKDITIEFINTQHSIIDTVFVAIHTPSGAVVYACDFKFDRTPTLGE
VPDFDRLKELGKEGVIALITESTNAGRNGKTPSELIAHMMLKDVLLGTEE
SAVGMIVTTFASHIARVNSIVQFAQEMGRIPVLLGRSMERYVGTAYQLGY
IDLPENVEIYGSRRDIDNALKKIMEAGKDKYLPVMTGHQGEPGAVLGRIA
NGETPFKVETGDRIIFSANVIPNPMTQANRYALETKLKMKGARIYDNVHV
SGHAYREDHWELLRMLKPEHVIPAHGTIQMHSEYIQMAEDAGYSLGDTLH
LLRNGEELYIEED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hab Molecular insights into catalysis and processive exonucleolytic mechanisms of prokaryotic RNase J revealing striking parallels with that of eukaryotic Xrn1
Resolution2.3 Å
Binding residue
(original residue number in PDB)
L37 L85 D86 F245 S247 R271 S272 T321 E326 A329 N354 I356 T361 H384 S386 G387 H388
Binding residue
(residue number reindexed from 1)
L52 L100 D101 F260 S262 R286 S287 T336 E341 A344 N369 I371 T376 H399 S401 G402 H403
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Feb 20 04:02:55 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5hab', asym_id = 'B', bs = 'BS01', title = 'Molecular insights into catalysis and processive... striking parallels with that of eukaryotic Xrn1 '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5hab', asym_id='B', bs='BS01', title='Molecular insights into catalysis and processive... striking parallels with that of eukaryotic Xrn1 ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0004534,0046872', uniprot = '', pdbid = '5hab', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0004534,0046872', uniprot='', pdbid='5hab', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>