Structure of PDB 5gnj Chain B Binding Site BS01

Receptor Information
>5gnj Chain B (length=77) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELK
SKVVKTESEKLQIKNQLEEVKLELAGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gnj Crystal Structure of Tetrameric Arabidopsis MYC2 Reveals the Mechanism of Enhanced Interaction with DNA.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		E457 R460
Binding residue
(residue number reindexed from 1)		E9 R12
Binding affinityPDBbind-CN: Kd=0.8uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5gnj, PDBe:5gnj, PDBj:5gnj
PDBsum5gnj
PubMed28514654
UniProtQ39204|MYC2_ARATH Transcription factor MYC2 (Gene Name=MYC2)

[Back to BioLiP]