Structure of PDB 5gkp Chain B Binding Site BS01

Receptor Information

>5gkp Chain B (length=239) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PSRSAEIMKHGYPGFTNVRTYEDFVLSYDYKTRTAHWVCEHLTPERLKHA
EGVDRKLCEAKPDITFPQKFLSQNTDYKCSGFDRGALAAAGNHRKSQLAV
DQTFYLSNMSPQVGRGFNRDKWNDLEMHCRRVAKKMINSYIITGPLYLPK
LEGDGKKYIKYQVIGDNNVAVPTHFFKVALFEVTPGKFELESYILPNAVI
ETVEISKFHVPLDAVERSAGLEIFARLDPKSIVKENGAK

Ligand information

>5gkp Chain D (length=5) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gkp Crystal structure of endonuclease G in complex with DNA reveals how it nonspecifically degrades DNA as a homodimer.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	R117 C141 D145 R146 G153 R181
Binding residue (residue number reindexed from 1)	R55 C79 D83 R84 G91 R119

Enzymatic activity

Enzyme Commision number

3.1.30.-

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0016787	hydrolase activity
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:5gkp, PDBe:5gkp, PDBj:5gkp
PDBsum	5gkp
PubMed	27738134
UniProt	Q95NM6\|NUCG_CAEEL Endonuclease G, mitochondrial (Gene Name=cps-6)

[Back to BioLiP]