Structure of PDB 5gki Chain B Binding Site BS01

Receptor Information
>5gki Chain B (length=239) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKDKVTVITSPSTEELVSLVNSALLEEAMLTIFARCKVHYDGRAKSELGS
GDRVIIVKPDGSFLIHQSKKREPVNWQPPGSRVRLELRENPVLVSIRRKP
RETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVIEPGFK
PLFREKAIGTGIVAVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILR
EEYGDKVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gki Structure of the EndoMS-DNA Complex as Mismatch Restriction Endonuclease
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K71 R72 E73 L128 I163 E179 K181 R182 R183 Q192 Y196
Binding residue
(residue number reindexed from 1)		K70 R71 E72 L127 I162 E178 K180 R181 R182 Q191 Y195
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0006259 DNA metabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gki, PDBe:5gki, PDBj:5gki
PDBsum5gki
PubMed27773688
UniProtQ5JER9|NUCS_THEKO Endonuclease NucS (Gene Name=nucS)

[Back to BioLiP]