Structure of PDB 5gkh Chain B Binding Site BS01

Receptor Information

>5gkh Chain B (length=239) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SKDKVTVITSPSTEELVSLVNSALLEEAMLTIFARCKVHYDGRAKSELGS
GDRVIIVKPDGSFLIHQSKKREPVNWQPPGSRVRLELRENPVLVSIRRKP
RETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVIEPGFK
PLFREKAIGTGIVAVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILR
EEYGDKVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR

Ligand information

>5gkh Chain C (length=15) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgtgccaggtgccgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gkh Structure of the EndoMS-DNA Complex as Mismatch Restriction Endonuclease
Resolution	2.9 Å
Binding residue (original residue number in PDB)	Y41 R44 A45 N76 W77 Q78 E103 R184 R191 T218 G220
Binding residue (residue number reindexed from 1)	Y40 R43 A44 N75 W76 Q77 E102 R183 R190 T217 G219

Enzymatic activity

Enzyme Commision number

3.1.-.-

Gene Ontology

	Molecular Function
GO:0000014	single-stranded DNA endodeoxyribonuclease activity
GO:0003676	nucleic acid binding
GO:0003677	DNA binding
GO:0004519	endonuclease activity

	Biological Process
GO:0006259	DNA metabolic process

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5gkh, PDBe:5gkh, PDBj:5gkh
PDBsum	5gkh
PubMed	27773688
UniProt	Q5JER9\|NUCS_THEKO Endonuclease NucS (Gene Name=nucS)

[Back to BioLiP]