Structure of PDB 5ggp Chain B Binding Site BS01

Receptor Information

>5ggp Chain B (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VLDVEVYSSRSKVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKR
VFDTYSPHEDEAMVLFLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLG
SQAGPALGWRDTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLLKTDVPLS

Ligand information

>5ggp Chain D (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TPTPVTAIG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ggp Carbohydrate-binding domain of the POMGnT1 stem region modulates O-mannosylation sites of alpha-dystroglycan
Resolution	1.599 Å
Binding residue (original residue number in PDB)	Y152 F183 W206
Binding residue (residue number reindexed from 1)	Y55 F86 W109

Enzymatic activity

Enzyme Commision number

2.4.1.-

External links

PDB	RCSB:5ggp, PDBe:5ggp, PDBj:5ggp
PDBsum	5ggp
PubMed	27493216
UniProt	Q8WZA1\|PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 (Gene Name=POMGNT1)

[Back to BioLiP]