Structure of PDB 5gap Chain B Binding Site BS01

Receptor Information

>5gap Chain B (length=71) Species: 4932 (Saccharomyces cerevisiae)

AKSTENEIPNLIEKMVAKGLNDLVEQYKFRETTHSKRELDSGDDQPQSSE
AKRTKFSNPAIPPVIDLEKIK

Ligand information

>5gap Chain W (length=56)

auuuggucaauuugaauacagagaucagcaguuccccugcauaaggauga
accguu

.........<<<..>>>.................................
......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5gap Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): Q388 Y389 K390
• Binding residue (residue number reindexed from 1): Q26 Y27 K28

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003724 RNA helicase activity
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11)
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005682 U5 snRNP
• GO:0046540 U4/U6 x U5 tri-snRNP complex

External links

• PDB: RCSB:5gap, PDBe:5gap, PDBj:5gap
• PDBsum: 5gap
• PubMed: 26829225
• UniProt: P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 (Gene Name=BRR2)