Structure of PDB 5fyq Chain B Binding Site BS01

Receptor Information
>5fyq Chain B (length=266) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPPYPEAI
FEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQN
IDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVV
KPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPL
STPRLLINKEKAGQGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKE
LEDLVRREHASIDAQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fyq Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R97 E116 V233 F235 G236 E237 L239 Q265 V266 Q267
Binding residue
(residue number reindexed from 1)		R42 E48 V155 F157 G158 E159 L161 Q187 V188 Q189
Enzymatic activity
Catalytic site (original residue number in PDB) P94 D95 F96 R97 N168 D170 H187
Catalytic site (residue number reindexed from 1) P39 D40 F41 R42 N100 D102 H119
Enzyme Commision number 2.3.1.-
2.3.1.286: protein acetyllysine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003950 NAD+-protein poly-ADP-ribosyltransferase activity
GO:0004407 histone deacetylase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0017136 NAD-dependent histone deacetylase activity
GO:0033558 protein lysine deacetylase activity
GO:0034979 NAD-dependent protein lysine deacetylase activity
GO:0035035 histone acetyltransferase binding
GO:0042826 histone deacetylase binding
GO:0042903 tubulin deacetylase activity
GO:0043130 ubiquitin binding
GO:0046872 metal ion binding
GO:0046970 NAD-dependent histone H4K16 deacetylase activity
GO:0051287 NAD binding
GO:0070403 NAD+ binding
GO:0140297 DNA-binding transcription factor binding
GO:0140773 NAD-dependent protein demyristoylase activity
GO:0140774 NAD-dependent protein depalmitoylase activity
GO:1990404 NAD+-protein ADP-ribosyltransferase activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000183 rDNA heterochromatin formation
GO:0006325 chromatin organization
GO:0006476 protein deacetylation
GO:0006914 autophagy
GO:0007084 mitotic nuclear membrane reassembly
GO:0007096 regulation of exit from mitosis
GO:0007399 nervous system development
GO:0010507 negative regulation of autophagy
GO:0010801 negative regulation of peptidyl-threonine phosphorylation
GO:0021762 substantia nigra development
GO:0022011 myelination in peripheral nervous system
GO:0030154 cell differentiation
GO:0031507 heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0031641 regulation of myelination
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0034599 cellular response to oxidative stress
GO:0034983 peptidyl-lysine deacetylation
GO:0040029 epigenetic regulation of gene expression
GO:0042177 negative regulation of protein catabolic process
GO:0042325 regulation of phosphorylation
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043388 positive regulation of DNA binding
GO:0043687 post-translational protein modification
GO:0044242 cellular lipid catabolic process
GO:0044546 NLRP3 inflammasome complex assembly
GO:0045087 innate immune response
GO:0045598 regulation of fat cell differentiation
GO:0045599 negative regulation of fat cell differentiation
GO:0045723 positive regulation of fatty acid biosynthetic process
GO:0045836 positive regulation of meiotic nuclear division
GO:0045843 negative regulation of striated muscle tissue development
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051301 cell division
GO:0051321 meiotic cell cycle
GO:0051726 regulation of cell cycle
GO:0051775 response to redox state
GO:0051781 positive regulation of cell division
GO:0051987 positive regulation of attachment of spindle microtubules to kinetochore
GO:0061433 cellular response to caloric restriction
GO:0070446 negative regulation of oligodendrocyte progenitor proliferation
GO:0071456 cellular response to hypoxia
GO:0071872 cellular response to epinephrine stimulus
GO:0090042 tubulin deacetylation
GO:1900119 positive regulation of execution phase of apoptosis
GO:1900195 positive regulation of oocyte maturation
GO:1900226 negative regulation of NLRP3 inflammasome complex assembly
GO:1902725 negative regulation of satellite cell differentiation
GO:2000378 negative regulation of reactive oxygen species metabolic process
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000792 heterochromatin
GO:0005634 nucleus
GO:0005677 chromatin silencing complex
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005813 centrosome
GO:0005814 centriole
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005886 plasma membrane
GO:0030426 growth cone
GO:0030496 midbody
GO:0033010 paranodal junction
GO:0033270 paranode region of axon
GO:0042995 cell projection
GO:0043204 perikaryon
GO:0043209 myelin sheath
GO:0043219 lateral loop
GO:0043220 Schmidt-Lanterman incisure
GO:0044224 juxtaparanode region of axon
GO:0048471 perinuclear region of cytoplasm
GO:0072686 mitotic spindle
GO:0072687 meiotic spindle
GO:0097386 glial cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fyq, PDBe:5fyq, PDBj:5fyq
PDBsum5fyq
PubMed27226597
UniProtQ8IXJ6|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 (Gene Name=SIRT2)

[Back to BioLiP]