Structure of PDB 5fvl Chain B Binding Site BS01

Receptor Information
>5fvl Chain B (length=78) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSK
DLIRAKFTEYLNRAEQLKKHLESEEANA
Ligand information
>5fvl Chain C (length=24) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MNPEKMNNAKVANMPSTEGLPSLP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fvl Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
Resolution1.973 Å
Binding residue
(original residue number in PDB)		T8 I11 I18 D21 Y26 K48 I56 K59 E62 Y63 R66 Q69
Binding residue
(residue number reindexed from 1)		T5 I8 I15 D18 Y23 K45 I53 K56 E59 Y60 R63 Q66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5fvl, PDBe:5fvl, PDBj:5fvl
PDBsum5fvl
PubMed27075672
UniProtP52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 (Gene Name=VPS4)

[Back to BioLiP]