Structure of PDB 5fpx Chain B Binding Site BS01

Receptor Information
>5fpx Chain B (length=107) Species: 393305 (Yersinia enterocolitica subsp. enterocolitica 8081) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMASKMFFINDETPWEELGNGIKRKVMTWSDDLMMVCVHFDKGAIGVAHK
HDIHDQIAYVAAGSFEVEIEGQKRILKAGDAYRAVKNEMHGAVSLEDNSI
LIDTFNP
Ligand information
>5fpx Chain F (length=8) Species: 393305 (Yersinia enterocolitica subsp. enterocolitica 8081) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSSHHHHH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fpx Kdgf, the Missing Link in the Microbial Metabolism of Uronate Sugars from Pectin and Alginate.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		L15 R21 G43 V44 H46 H48 Q53 Y79 H87 L98 D100 F102
Binding residue
(residue number reindexed from 1)		L18 R24 G46 V47 H49 H51 Q56 Y82 H90 L101 D103 F105
Enzymatic activity
Enzyme Commision number ?
External links