Structure of PDB 5fmp Chain B Binding Site BS01

Receptor Information
>5fmp Chain B (length=183) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSK
VHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLL
TEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVI
SDVWLSNLLAWLTRRASATDVSKRLDLAVRLLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fmp Kstr, Transcriptional Repressor of Cholesterol Degradation in Mycobacterium Tuberculosis
Resolution2.26 Å
Binding residue
(original residue number in PDB)		Q59 R61 Y75 S80 K81
Binding residue
(residue number reindexed from 1)		Q28 R30 Y44 S49 K50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5fmp, PDBe:5fmp, PDBj:5fmp
PDBsum5fmp
PubMed
UniProtP96856|KSTR_MYCTU HTH-type transcriptional repressor KstR (Gene Name=kstR)

[Back to BioLiP]