Structure of PDB 5fhd Chain B Binding Site BS01

Receptor Information
>5fhd Chain B (length=400) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEDMILTEEMQKIMNLIQDDENNVFVTGKAGSGKTTFLKYLIEKSGKNCI
VAAPTGIAAINAGGVTLHSLFGIPFGPITPYDRLENKFSEYKVELLLKME
LLIIDEISMVRPDILDTIDRKLRWVYESDEPFGGVQVVMFGDLFQLPPVT
KKQEREILSDFYDGFFFFNALVFKRTGFHIVELTKIFRQTEPEFINVLNN
IRNYQVTSDELDLLSELKDRKISSSYDNEYIHICTHKADVEKINADKLGQ
EIRNYDIVSIPCDLHLKLRARVMSLVNDSLYYNGMLGIVTALEDNTVRMD
NGRTIKFERYTWSSCTQFPLTLAWAITIHKSQGLTFDKIIIHVSHTFCPG
QLYVALSRCRTLEGIVSDAFITKQMIIPEYALIDFERAYKSEGNYYGKRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fhd Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1
Resolution2.0 Å
Binding residue
(original residue number in PDB)
P54 T55 T66 H68 S69 G72 I73 F75 S89 Y91 K92 V149 K151 H236 T359 H361 K362 F379
Binding residue
(residue number reindexed from 1)
P54 T55 T66 H68 S69 G72 I73 F75 S89 Y91 K92 V149 K151 H236 T327 H329 K330 F347
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Nov 26 05:13:04 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5fhd', asym_id = 'B', bs = 'BS01', title = 'Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5fhd', asym_id='B', bs='BS01', title='Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000723,0003678,0006281', uniprot = '', pdbid = '5fhd', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000723,0003678,0006281', uniprot='', pdbid='5fhd', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>