Structure of PDB 5fgb Chain B Binding Site BS01

Receptor Information

>5fgb Chain B (length=212) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SYELTQLPSLSVSLGQTASITCSGDNLGDKFVCWYQQKPGQTPVLVMYED
TKRPSGIPERFAGSNSGNTATLTITGTQAMDEADYYCQTWDSSTDVVFGG
GTKLTVLRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
DNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRG

Ligand information

>5fgb Chain G (length=4) Species: 11108 (Hepatitis C virus (isolate H)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GSWH

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5fgb Antibody Response to Hypervariable Region 1 Interferes with Broadly Neutralizing Antibodies to Hepatitis C Virus.
Resolution	1.65 Å
Binding residue (original residue number in PDB)	W90 D95 V96
Binding residue (residue number reindexed from 1)	W90 D95 V96

External links

PDB	RCSB:5fgb, PDBe:5fgb, PDBj:5fgb
PDBsum	5fgb
PubMed	26739044

[Back to BioLiP]