Structure of PDB 5ffv Chain B Binding Site BS01

Receptor Information
>5ffv Chain B (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMK
QNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVL
RQARRQAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ffv Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone peptide
Resolution1.3 Å
Binding residue
(original residue number in PDB)
G650 I652 V657 D664 H668 Y707 N708 F714
Binding residue
(residue number reindexed from 1)
G21 I23 V28 D35 H39 Y78 N79 F85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ffv, PDBe:5ffv, PDBj:5ffv
PDBsum5ffv
PubMed
UniProtP55201|BRPF1_HUMAN Peregrin (Gene Name=BRPF1)

[Back to BioLiP]