Structure of PDB 5fdk Chain B Binding Site BS01

Receptor Information
>5fdk Chain B (length=166) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLEDDLNETNKYYLTNQIAVIHKKPTPVQIVNVHYPKRSAAVIKEAYFKQ
SSTTNYNGIYKGRYIDFEAKETKNKTSFPLQNFHDHQIEHMKQVKAQDGI
CFVIISAFDQVYFLEADKLFYFWDRKEKNGRKSIRKDELEETAYPISLGY
APRIDYISIIEQLYFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fdk Structural insights into dynamics of RecU-HJ complex formation elucidates key role of NTR and stalk region toward formation of reactive state.
Resolution3.208 Å
Binding residue
(original residue number in PDB)		T109 S110 Q114 R164 K165 S166
Binding residue
(residue number reindexed from 1)		T76 S77 Q81 R131 K132 S133
Enzymatic activity
Enzyme Commision number 3.1.21.10: crossover junction endodeoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0007059 chromosome segregation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fdk, PDBe:5fdk, PDBj:5fdk
PDBsum5fdk
PubMed27903910
UniProtP39792|RECU_BACSU Holliday junction resolvase RecU (Gene Name=recU)

[Back to BioLiP]