Structure of PDB 5f88 Chain B Binding Site BS01

Receptor Information

>5f88 Chain B (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGV
IWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALT
YYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKRVEPK

Ligand information

>5f88 Chain E (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CQFDYSTRRLKC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5f88 Natural and non-natural amino-acid side-chain substitutions: affinity and diffraction studies of meditope-Fab complexes.
Resolution	2.481 Å
Binding residue (original residue number in PDB)	Q39 P41 T90 I92 Q111 L114 E154 P173
Binding residue (residue number reindexed from 1)	Q39 P41 T90 I92 Q111 L114 E150 P169

External links

PDB	RCSB:5f88, PDBe:5f88, PDBj:5f88
PDBsum	5f88
PubMed	27834791

[Back to BioLiP]