Structure of PDB 5f67 Chain B Binding Site BS01

Receptor Information
>5f67 Chain B (length=97) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDETKFIFDQFPKARTVQVRKEGFLGIMVIYGKHAEVGSGIFISDLREGS
NAELAGVKVGDMLLAVNQDVTLESNYDDATGLLKRAEGVVTMILLTL
Ligand information
>5f67 Chain D (length=19) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GPGSRGKSTVTGRMISGWL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f67 An Exquisitely Specific PDZ/Target Recognition Revealed by the Structure of INAD PDZ3 in Complex with TRP Channel Tail
Resolution1.76 Å
Binding residue
(original residue number in PDB)		F374 L375 G376 I377 M378 D395 L396 R397 E398
Binding residue
(residue number reindexed from 1)		F24 L25 G26 I27 M28 D45 L46 R47 E48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5f67, PDBe:5f67, PDBj:5f67
PDBsum5f67
PubMed26853938
UniProtQ24008|INAD_DROME Inactivation-no-after-potential D protein (Gene Name=inaD)

[Back to BioLiP]