Structure of PDB 5ev0 Chain B Binding Site BS01

Receptor Information
>5ev0 Chain B (length=133) Species: 4212 (Ambrosia artemisiifolia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSWQTYVDEHLMCDIEGTGQHLASAAIFGTDGNVWAKSSSFPEFKPDEIN
AIIKEFSEPGALAPTGLFLAGAKYMVIQGEPGAVIRGKKGAGGICIKKTG
QAMVFGIYEEPVNPGQCNMVVERLGDYLVDQGM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ev0 Structural, Functional, and Immunological Characterization of Profilin Panallergens Amb a 8, Art v 4, and Bet v 2.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Q78 R86
Binding residue
(residue number reindexed from 1)		Q78 R86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0003785 actin monomer binding
Biological Process
GO:0042989 sequestering of actin monomers
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005938 cell cortex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ev0, PDBe:5ev0, PDBj:5ev0
PDBsum5ev0
PubMed27231348
UniProtQ2KN24

[Back to BioLiP]