Structure of PDB 5epl Chain B Binding Site BS01

Receptor Information
>5epl Chain B (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLI
AFQNRERQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5epl A cellular chemical probe targeting the chromodomains of Polycomb repressive complex 1.
Resolution1.81 Å
Binding residue
(original residue number in PDB)
A12 R33
Binding residue
(residue number reindexed from 1)
A7 R28
Enzymatic activity
Enzyme Commision number 2.3.2.-
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5epl, PDBe:5epl, PDBj:5epl
PDBsum5epl
PubMed26807715
UniProtO00257|CBX4_HUMAN E3 SUMO-protein ligase CBX4 (Gene Name=CBX4)

[Back to BioLiP]